PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn312091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 164aa    MW: 18580.7 Da    PI: 6.8583
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn312091genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.21.6e-3961051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk lrr+C++dCvlapyfpa++p++fa+vh+++Gasnv+k+l++lp e r+da++++++eA  r++dPvyG++++i+klqqq+ q++ e+a++++
  Achn312091   6 RCAACKSLRRRCSQDCVLAPYFPANNPQRFACVHRIYGASNVTKILEKLPVESRSDAADCMTFEASSRIQDPVYGSTQTIFKLQQQIVQTQYEIAKVQA 104
                 6***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Achn312091 105 E 105
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.485106IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-386103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MSNSTRCAAC KSLRRRCSQD CVLAPYFPAN NPQRFACVHR IYGASNVTKI LEKLPVESRS  60
DAADCMTFEA SSRIQDPVYG STQTIFKLQQ QIVQTQYEIA KVQAELAMHN AQQQMHQIQQ  120
QQDHQNQNHL LGQSSLMNVN SAASEQEEEF HYLDQQQLGG FYH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278070.18e-53PREDICTED: LOB domain-containing protein 24-like
SwissprotP594687e-45LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9HV381e-51B9HV38_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s25720.12e-44(Populus trichocarpa)
STRINGGSMUA_Achr11P04980_0013e-44(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.14e-45LOB domain-containing protein 23